Lineage for d1e3oc2 (1e3o C:1-75)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768002Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 768003Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) (S)
  5. 768004Family a.35.1.1: POU-specific domain [47414] (3 proteins)
  6. 768009Protein Oct-1 [47415] (1 species)
    canonical 4-helical fold
  7. 768010Species Human (Homo sapiens) [TaxId:9606] [47416] (7 PDB entries)
  8. 768011Domain d1e3oc2: 1e3o C:1-75 [59198]
    Other proteins in same PDB: d1e3oc1
    mutant

Details for d1e3oc2

PDB Entry: 1e3o (more details), 1.9 Å

PDB Description: crystal structure of oct-1 pou dimer bound to more
PDB Compounds: (C:) octamer-binding transcription factor 1

SCOP Domain Sequences for d1e3oc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3oc2 a.35.1.1 (C:1-75) Oct-1 {Human (Homo sapiens) [TaxId: 9606]}
eepsdleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknm
sklkpllekwlndae

SCOP Domain Coordinates for d1e3oc2:

Click to download the PDB-style file with coordinates for d1e3oc2.
(The format of our PDB-style files is described here.)

Timeline for d1e3oc2: