Lineage for d1e3nb_ (1e3n B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78424Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 78540Superfamily d.17.4: NTF2-like [54427] (4 families) (S)
  5. 78576Family d.17.4.3: Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54434] (1 protein)
  6. 78577Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)
  7. 78590Species Pseudomonas putida [TaxId:303] [54437] (9 PDB entries)
  8. 78598Domain d1e3nb_: 1e3n B: [59196]

Details for d1e3nb_

PDB Entry: 1e3n (more details), 2 Å

PDB Description: high resolution crystal structure of pi ketosteroid isomerase mutant d40n(d38n, ti numbering) complexed with equilenin at 2.0 a resolution.

SCOP Domain Sequences for d1e3nb_:

Sequence, based on SEQRES records: (download)

>d1e3nb_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida}
nlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl
gggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayws
evnlsv

Sequence, based on observed residues (ATOM records): (download)

>d1e3nb_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida}
nlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl
gkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqaywsev
nlsv

SCOP Domain Coordinates for d1e3nb_:

Click to download the PDB-style file with coordinates for d1e3nb_.
(The format of our PDB-style files is described here.)

Timeline for d1e3nb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1e3na_