Lineage for d1e3kb_ (1e3k B:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 217440Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 217441Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 217442Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (20 proteins)
  6. 217542Protein Progesterone receptor [48517] (1 species)
  7. 217543Species Human (Homo sapiens) [TaxId:9606] [48518] (2 PDB entries)
  8. 217547Domain d1e3kb_: 1e3k B: [59194]
    complexed with r18

Details for d1e3kb_

PDB Entry: 1e3k (more details), 2.8 Å

PDB Description: human progesteron receptor ligand binding domain in complex with the ligand metribolone (r1881)

SCOP Domain Sequences for d1e3kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3kb_ a.123.1.1 (B:) Progesterone receptor {Human (Homo sapiens)}
lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl
hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg
vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila
gmvkpllfh

SCOP Domain Coordinates for d1e3kb_:

Click to download the PDB-style file with coordinates for d1e3kb_.
(The format of our PDB-style files is described here.)

Timeline for d1e3kb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1e3ka_