Lineage for d1e3ga_ (1e3g A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 217440Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 217441Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 217442Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (20 proteins)
  6. 217443Protein Androgen receptor [63621] (2 species)
  7. 217444Species Human (Homo sapiens) [TaxId:9606] [63623] (1 PDB entry)
  8. 217445Domain d1e3ga_: 1e3g A: [59192]
    complexed with r18

Details for d1e3ga_

PDB Entry: 1e3g (more details), 2.4 Å

PDB Description: human androgen receptor ligand binding in complex with the ligand metribolone (r1881)

SCOP Domain Sequences for d1e3ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3ga_ a.123.1.1 (A:) Androgen receptor {Human (Homo sapiens)}
cqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnl
hvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmr
hlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrkn
ptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkils
gkvkpiyfht

SCOP Domain Coordinates for d1e3ga_:

Click to download the PDB-style file with coordinates for d1e3ga_.
(The format of our PDB-style files is described here.)

Timeline for d1e3ga_: