Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins) |
Protein Staphylococcal enterotoxin A, SEA [50220] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [50221] (6 PDB entries) |
Domain d1dyqa1: 1dyq A:6-120 [59140] Other proteins in same PDB: d1dyqa2 mutant vaccine complexed with so4, zn; mutant |
PDB Entry: 1dyq (more details), 1.5 Å
SCOPe Domain Sequences for d1dyqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dyqa1 b.40.2.2 (A:6-120) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus [TaxId: 1280]} einekdlrkkselqgtalgnlkqiyyynekaktenkeshdqfrqhtilfkgfftdhswyn dllvrfdskdivdkykgkkvdlygayagyqcaggtpnktacmyggvtlhdnnrlt
Timeline for d1dyqa1: