Lineage for d1dyqa1 (1dyq A:6-120)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 296865Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 297207Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)
  6. 297208Protein Staphylococcal enterotoxin A, SEA [50220] (1 species)
  7. 297209Species Staphylococcus aureus [TaxId:1280] [50221] (6 PDB entries)
  8. 297219Domain d1dyqa1: 1dyq A:6-120 [59140]
    Other proteins in same PDB: d1dyqa2
    mutant vaccine

Details for d1dyqa1

PDB Entry: 1dyq (more details), 1.5 Å

PDB Description: staphylococcal enterotoxin a mutant vaccine

SCOP Domain Sequences for d1dyqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dyqa1 b.40.2.2 (A:6-120) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus}
einekdlrkkselqgtalgnlkqiyyynekaktenkeshdqfrqhtilfkgfftdhswyn
dllvrfdskdivdkykgkkvdlygayagyqcaggtpnktacmyggvtlhdnnrlt

SCOP Domain Coordinates for d1dyqa1:

Click to download the PDB-style file with coordinates for d1dyqa1.
(The format of our PDB-style files is described here.)

Timeline for d1dyqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dyqa2