Lineage for d1dyqa1 (1dyq A:6-120)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 110053Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 110115Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 110417Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)
  6. 110418Protein Staphylococcal enterotoxin A, SEA [50220] (1 species)
  7. 110419Species Staphylococcus aureus [TaxId:1280] [50221] (5 PDB entries)
  8. 110428Domain d1dyqa1: 1dyq A:6-120 [59140]
    Other proteins in same PDB: d1dyqa2

Details for d1dyqa1

PDB Entry: 1dyq (more details), 1.5 Å

PDB Description: staphylococcal enterotoxin a mutant vaccine

SCOP Domain Sequences for d1dyqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dyqa1 b.40.2.2 (A:6-120) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus}
einekdlrkkselqgtalgnlkqiyyynekaktenkeshdqfrqhtilfkgfftdhswyn
dllvrfdskdivdkykgkkvdlygayagyqcaggtpnktacmyggvtlhdnnrlt

SCOP Domain Coordinates for d1dyqa1:

Click to download the PDB-style file with coordinates for d1dyqa1.
(The format of our PDB-style files is described here.)

Timeline for d1dyqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dyqa2