Lineage for d1d4xg_ (1d4x G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2969655Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2969656Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2969657Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 2969658Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 2969675Species Human (Homo sapiens) [TaxId:9606] [55761] (47 PDB entries)
    Uniprot P20065 55-179
  8. 2969681Domain d1d4xg_: 1d4x G: [59109]
    Other proteins in same PDB: d1d4xa1, d1d4xa2
    complexed with atp, ca, mg, so2, so4

Details for d1d4xg_

PDB Entry: 1d4x (more details), 1.75 Å

PDB Description: crystal structure of caenorhabditis elegans mg-atp actin complexed with human gelsolin segment 1 at 1.75 a resolution.
PDB Compounds: (G:) gelsolin

SCOPe Domain Sequences for d1d4xg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d4xg_ d.109.1.1 (G:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
vehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlh
ywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggva
sgfk

SCOPe Domain Coordinates for d1d4xg_:

Click to download the PDB-style file with coordinates for d1d4xg_.
(The format of our PDB-style files is described here.)

Timeline for d1d4xg_: