SCOPe 2.08: Domain d1d4xa1: 1d4x A:4-146

Lineage for d1d4xa1 (1d4x A:4-146)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (10 species)

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [64086] (1 PDB entry)

8. Domain d1d4xa1: 1d4x A:4-146 [59107]
   Other proteins in same PDB: d1d4xg_
   complexed with atp, ca, mg, so2, so4

Details for d1d4xa1

PDB Entry: 1d4x, 1.75 Å

PDB Description: crystal structure of caenorhabditis elegans mg-atp actin complexed with human gelsolin segment 1 at 1.75 a resolution.

PDB Compounds: (A:) c. elegans actin 1/3

SCOPe Domain Sequences for d1d4xa1:

Sequence, based on SEQRES records:

>d1d4xa1 c.55.1.1 (A:4-146) Actin {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
evaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg
iltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqim
fetfntpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d1d4xa1 c.55.1.1 (A:4-146) Actin {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
evaalvvdngsgmckagfagddapravfpsivgrprhqgvgqkdsyvgdeaqskrgiltl
kypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetf
ntpamyvaiqavlslyasg

Timeline for d1d4xa1:

• d1d4xa1 first appeared in SCOP 1.57
  
• d1d4xa1 appears in SCOPe 2.07