Lineage for d1c7ka_ (1c7k A:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (13 families) 
Family d.92.1.1: Zinc protease [55487] (1 protein) Protein Zinc protease [55488] (1 species) Species Streptomyces caespitosus [TaxId:53502] [55489] (2 PDB entries) 
Domain d1c7ka_: 1c7k A: [59078]
Details for d1c7ka_
PDB Entry: 1c7k (more details), 1 Å
PDB Description: crystal structure of the zinc protease
SCOP Domain Sequences for d1c7ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c7ka_ d.92.1.1 (A:) Zinc protease {Streptomyces caespitosus}
tvtvtydpsnapsfqqeianaaqiwnssvrnvqlraggnadfsyyegndsrgsyaqtdgh
grgyifldyqqnqqydstrvtahetghvlglpdhyqgpcselmsgggpgpsctnpypnaq
ersrvnalwang
SCOP Domain Coordinates for d1c7ka_:
Click to download the PDB-style file with coordinates for d1c7ka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c7ka_:
- d1c7ka_ is new in SCOP 1.57
- d1c7ka_ appears in SCOP 1.59
- d1c7ka_ appears in the current release, SCOPe 2.08
View in 3D