Lineage for d3bccb2 (3bcc B:236-439)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1943314Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 1943315Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 1943316Family d.185.1.1: MPP-like [63412] (7 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 1943389Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
  7. 1943411Species Chicken (Gallus gallus) [TaxId:9031] [56001] (3 PDB entries)
  8. 1943417Domain d3bccb2: 3bcc B:236-439 [59059]
    Other proteins in same PDB: d3bcca1, d3bcca2, d3bccc2, d3bccc3, d3bccd2, d3bccd3, d3bcce1, d3bcce2, d3bccf_, d3bccg_, d3bcch_, d3bccj_
    complexed with amy, fes, hem, sig

Details for d3bccb2

PDB Entry: 3bcc (more details), 3.7 Å

PDB Description: stigmatellin and antimycin bound cytochrome bc1 complex from chicken
PDB Compounds: (B:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d3bccb2:

Sequence, based on SEQRES records: (download)

>d3bccb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus) [TaxId: 9031]}
kakyrggeireqngdslvhaaivaesaaiggaeanafsvlqhvlganphvkrglnatssl
yqavakgvhqpfdvsafnasysdsglfgfytisqaayagqvikaaynqvktiaqgnvsne
nvqaaknklkakylmsvessegfleevgsqalaagsynppstvlqqidavadadvikaak
kfvsrqksmaasgnlghtpfvdel

Sequence, based on observed residues (ATOM records): (download)

>d3bccb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus) [TaxId: 9031]}
kakyrggeireqngdslvhaaivaesaaiggaeanafsvlqhvlganphvkrgnpfdvsa
fnasysdsglfgfytisqaayagqvikaaynqvktiaqgnvsnenvqaaknklkakylms
vessegfleevgsqalaagsynppstvlqqidavadadvikaakkfvsrqksmaasgnlg
htpfvdel

SCOPe Domain Coordinates for d3bccb2:

Click to download the PDB-style file with coordinates for d3bccb2.
(The format of our PDB-style files is described here.)

Timeline for d3bccb2: