SCOP 1.69: Domain d3bccb2: 3bcc B:236-439

Lineage for d3bccb2 (3bcc B:236-439)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (4 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Cytochrome bc1 core subunit 2 [63409] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [56001] (3 PDB entries)

8. Domain d3bccb2: 3bcc B:236-439 [59059]
   Other proteins in same PDB: d3bcca1, d3bcca2, d3bccc2, d3bccc3, d3bccd2, d3bccd3, d3bcce1, d3bcce2, d3bccf_, d3bccg_, d3bcch_, d3bccj_

Details for d3bccb2

PDB Entry: 3bcc, 3.7 Å

PDB Description: stigmatellin and antimycin bound cytochrome bc1 complex from chicken

SCOP Domain Sequences for d3bccb2:

Sequence, based on SEQRES records:

>d3bccb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus)}
kakyrggeireqngdslvhaaivaesaaiggaeanafsvlqhvlganphvkrglnatssl
yqavakgvhqpfdvsafnasysdsglfgfytisqaayagqvikaaynqvktiaqgnvsne
nvqaaknklkakylmsvessegfleevgsqalaagsynppstvlqqidavadadvikaak
kfvsrqksmaasgnlghtpfvdel

Sequence, based on observed residues (ATOM records):

>d3bccb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus)}
kakyrggeireqngdslvhaaivaesaaiggaeanafsvlqhvlganphvkrgnpfdvsa
fnasysdsglfgfytisqaayagqvikaaynqvktiaqgnvsnenvqaaknklkakylms
vessegfleevgsqalaagsynppstvlqqidavadadvikaakkfvsrqksmaasgnlg
htpfvdel

Timeline for d3bccb2:

• d3bccb2 first appeared in SCOP 1.57
  
• d3bccb2 appears in SCOP 1.67
  
• d3bccb2 appears in SCOP 1.71
  
• d3bccb2 appears in the current release, SCOPe 2.08