SCOPe 2.03: Domain d3bccb1: 3bcc B:18-235

Lineage for d3bccb1 (3bcc B:18-235)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (6 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Cytochrome bc1 core subunit 2 [63409] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [56001] (3 PDB entries)

8. Domain d3bccb1: 3bcc B:18-235 [59058]
   Other proteins in same PDB: d3bcca1, d3bcca2, d3bccc2, d3bccc3, d3bccd2, d3bccd3, d3bcce1, d3bcce2, d3bccf_, d3bccg_, d3bcch_, d3bccj_
   complexed with amy, fes, hem, sig

Details for d3bccb1

PDB Entry: 3bcc, 3.7 Å

PDB Description: stigmatellin and antimycin bound cytochrome bc1 complex from chicken

PDB Compounds: (B:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d3bccb1:

Sequence; same for both SEQRES and ATOM records:

>d3bccb1 d.185.1.1 (B:18-235) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus) [TaxId: 9031]}
pphpqdleitklpnglviaslenyspgstigvfikagsryenssnlgtshllrlassltt
kgassfkitrgieavggklsvestrenmaytveclrddveilmefllnvttapefrpwev
adlqpqlkidkavafqnpqthvienlhaaayrnaladslycpdyrigkvtsvelhdfvqn
hftsarmalvglgvshpvlknvaeqllnirgglglsga

Timeline for d3bccb1:

• d3bccb1 first appeared in SCOP 1.57
  
• d3bccb1 appears in SCOPe 2.02
  
• d3bccb1 appears in SCOPe 2.04
  
• d3bccb1 appears in the current release, SCOPe 2.08