Lineage for d2bccb2 (2bcc B:236-439)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1049845Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 1049846Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 1049847Family d.185.1.1: MPP-like [63412] (6 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 1049922Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
  7. 1049944Species Chicken (Gallus gallus) [TaxId:9031] [56001] (9 PDB entries)
  8. 1049962Domain d2bccb2: 2bcc B:236-439 [59052]
    Other proteins in same PDB: d2bcca1, d2bcca2, d2bccc2, d2bccc3, d2bccd2, d2bccd3, d2bcce1, d2bcce2, d2bccf_, d2bccg_, d2bcch_, d2bccj_
    complexed with bog, fes, hem, pee, sig, u10

Details for d2bccb2

PDB Entry: 2bcc (more details), 3.5 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken
PDB Compounds: (B:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d2bccb2:

Sequence, based on SEQRES records: (download)

>d2bccb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus) [TaxId: 9031]}
kakyrggeireqngdslvhaaivaesaaiggaeanafsvlqhvlganphvkrglnatssl
yqavakgvhqpfdvsafnasysdsglfgfytisqaayagqvikaaynqvktiaqgnvsne
nvqaaknklkakylmsvessegfleevgsqalaagsynppstvlqqidavadadvikaak
kfvsrqksmaasgnlghtpfvdel

Sequence, based on observed residues (ATOM records): (download)

>d2bccb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus) [TaxId: 9031]}
kakyrggeireqngdslvhaaivaesaaiggaeanafsvlqhvlganphvkrgnpfdvsa
fnasysdsglfgfytisqaayagqvikaaynqvktiaqgnvsnenvqaaknklkakylms
vessegfleevgsqalaagsynppstvlqqidavadadvikaakkfvsrqksmaasgnlg
htpfvdel

SCOPe Domain Coordinates for d2bccb2:

Click to download the PDB-style file with coordinates for d2bccb2.
(The format of our PDB-style files is described here.)

Timeline for d2bccb2: