SCOP 1.57: Domain d2bccb1: 2bcc B:18-235

Lineage for d2bccb1 (2bcc B:18-235)

Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)
Family d.185.1.1: MPP-like [63412] (4 proteins)
Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
Species Chicken (Gallus gallus) [TaxId:9031] [56001] (3 PDB entries)
Domain d2bccb1: 2bcc B:18-235 [59051]
Other proteins in same PDB: d2bcca1, d2bcca2, d2bccc1, d2bccd2, d2bccd3, d2bcce1, d2bcce2, d2bccf1, d2bccg1, d2bcch1, d2bccj1

Details for d2bccb1

PDB Entry: 2bcc (more details), 3.5 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken

SCOP Domain Sequences for d2bccb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bccb1 d.185.1.1 (B:18-235) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus)}
pphpqdleitklpnglviaslenyspgstigvfikagsryenssnlgtshllrlassltt
kgassfkitrgieavggklsvestrenmaytveclrddveilmefllnvttapefrpwev
adlqpqlkidkavafqnpqthvienlhaaayrnaladslycpdyrigkvtsvelhdfvqn
hftsarmalvglgvshpvlknvaeqllnirgglglsga

SCOP Domain Coordinates for d2bccb1:

Click to download the PDB-style file with coordinates for d2bccb1.
(The format of our PDB-style files is described here.)

Timeline for d2bccb1: