SCOP 1.57: Domain d2bcca2: 2bcc A:233-445

Lineage for d2bcca2 (2bcc A:233-445)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)

5. Family d.185.1.1: MPP-like [63412] (4 proteins)

6. Protein Cytochrome bc1 core subunit 1 [63408] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [55998] (3 PDB entries)

8. Domain d2bcca2: 2bcc A:233-445 [59050]
   Other proteins in same PDB: d2bccb1, d2bccb2, d2bccc1, d2bccd2, d2bccd3, d2bcce1, d2bcce2, d2bccf1, d2bccg1, d2bcch1, d2bccj1

Details for d2bcca2

PDB Entry: 2bcc, 3.5 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken

SCOP Domain Sequences for d2bcca2:

Sequence; same for both SEQRES and ATOM records:

>d2bcca2 d.185.1.1 (A:233-445) Cytochrome bc1 core subunit 1 {Chicken (Gallus gallus)}
kcrftgsqirhredglplahvaiavegpgwahpdlvalqvanaiighydrtyggglhsss
plasiavtnklcqsfqtfsicysetglfgfyfvcdrmsiddmmfvlqgqwmrlctsises
evlrgknflrnalvshldgttpvcedigrelltygrripleeweerlaevdarmvrevcs
kyiydqcpavagpgpieqlpdynrirsgmfwlr

Timeline for d2bcca2:

• d2bcca2 is new in SCOP 1.57
  
• d2bcca2 appears in SCOP 1.59
  
• d2bcca2 appears in the current release, SCOPe 2.08