SCOPe 2.04: Domain d2bcca1: 2bcc A:4-232

Lineage for d2bcca1 (2bcc A:4-232)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (7 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Cytochrome bc1 core subunit 1 [63408] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [55998] (3 PDB entries)

8. Domain d2bcca1: 2bcc A:4-232 [59049]
   Other proteins in same PDB: d2bccb1, d2bccb2, d2bccc2, d2bccc3, d2bccd2, d2bccd3, d2bcce1, d2bcce2, d2bccf_, d2bccg_, d2bcch_, d2bccj_
   complexed with bog, fes, hem, pee, sig, u10

Details for d2bcca1

PDB Entry: 2bcc, 3.5 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken

PDB Compounds: (A:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d2bcca1:

Sequence; same for both SEQRES and ATOM records:

>d2bcca1 d.185.1.1 (A:4-232) Cytochrome bc1 core subunit 1 {Chicken (Gallus gallus) [TaxId: 9031]}
yaqalqsvpetqvsqldngvrvaseqssqptctvgvwidagsryeseknngagyflehla
fkgtknrpqnalekevesmgahlnayssrehtayyikalskdvpkavelladivqncsle
dsqiekerdvivrelqendtsmrevvfnylhatafqgtglaqsvegpsenirklsradlt
eylsthytaprmvlaaaggvehqqllelaqkhfggvpftydddavptls

Timeline for d2bcca1:

• d2bcca1 first appeared in SCOP 1.57
  
• d2bcca1 appears in SCOPe 2.03
  
• d2bcca1 appears in SCOPe 2.05
  
• d2bcca1 appears in the current release, SCOPe 2.08