Lineage for d1ruxa1 (1rux A:5-636)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 304390Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 304410Superfamily b.121.2: Group II dsDNA viruses VP [49749] (3 families) (S)
    duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits
    trimeric; in the trimers, the domains are arranged around pseudo six-fold axis
  5. 304432Family b.121.2.2: Adenovirus hexon [49753] (1 protein)
    each domain is heavily decorated with many insertions
  6. 304433Protein Adenovirus hexon [63404] (2 species)
  7. 304437Species Human adenovirus type 5 [TaxId:28285] [49756] (1 PDB entry)
  8. 304438Domain d1ruxa1: 1rux A:5-636 [59040]

Details for d1ruxa1

PDB Entry: 1rux (more details), 2.5 Å

PDB Description: maximum likelihood refinement of adenovirus type 5 hexon with tnt

SCOP Domain Sequences for d1ruxa1:

Sequence, based on SEQRES records: (download)

>d1ruxa1 b.121.2.2 (A:5-636) Adenovirus hexon {Human adenovirus type 5}
mmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqrlt
lrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtaynala
pkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginitkegiq
igvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakptneng
gqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthisympt
ikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvdlqdrn
telsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggvintet
ltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialylpdkl
kyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrnaglry
rsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndlrvdg
asikfdsiclyatffpmahntastleamlrnd

Sequence, based on observed residues (ATOM records): (download)

>d1ruxa1 b.121.2.2 (A:5-636) Adenovirus hexon {Human adenovirus type 5}
mmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqrlt
lrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtaynala
pkgapnpcewdthvfgqapysginitkegiqigkyadktfqpepqigesqwyeteinhaa
grvlkkttpmkpcygsyakptnenggqgilvesqvemqffsttnltpkvvlysedvdiet
pdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasql
navvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycf
plggvintetltkvkpgwekdafsdkneirvgnnfameinlnanlwrnflysnialylpd
klkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrnagl
ryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndlrv
dgasikfdsiclyatffpmahntastleamlrnd

SCOP Domain Coordinates for d1ruxa1:

Click to download the PDB-style file with coordinates for d1ruxa1.
(The format of our PDB-style files is described here.)

Timeline for d1ruxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ruxa2