Lineage for d1qqjb1 (1qqj B:1-118)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58264Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 58584Superfamily b.34.8: Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63433] (1 family) (S)
  5. 58585Family b.34.8.1: Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63434] (1 protein)
  6. 58586Protein Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63435] (1 species)
  7. 58587Species Mouse (Mus musculus) [TaxId:10090] [63436] (4 PDB entries)
  8. 58591Domain d1qqjb1: 1qqj B:1-118 [59036]
    Other proteins in same PDB: d1qqja2, d1qqjb2

Details for d1qqjb1

PDB Entry: 1qqj (more details), 1.55 Å

PDB Description: crystal structure of mouse fumarylacetoacetate hydrolase refined at 1.55 angstrom resolution

SCOP Domain Sequences for d1qqjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qqjb1 b.34.8.1 (B:1-118) Fumarylacetoacetate hydrolase, FAH, N-terminal domain {Mouse (Mus musculus)}
msfipvaedsdfpiqnlpygvfstqsnpkprigvaigdqildlsvikhlftgpalskhqh
vfdettlnnfmglgqaawkearaslqnllsasqarlrddkelrqraftsqasatmhlp

SCOP Domain Coordinates for d1qqjb1:

Click to download the PDB-style file with coordinates for d1qqjb1.
(The format of our PDB-style files is described here.)

Timeline for d1qqjb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qqjb2