Lineage for d1qqja2 (1qqj A:119-416)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2561549Fold d.177: FAH [56528] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure
  4. 2561550Superfamily d.177.1: FAH [56529] (2 families) (S)
  5. 2561551Family d.177.1.1: FAH [56530] (7 proteins)
    automatically mapped to Pfam PF01557
  6. 2561581Protein Fumarylacetoacetate hydrolase, FAH, C-terminal domain [63432] (1 species)
  7. 2561582Species Mouse (Mus musculus) [TaxId:10090] [56532] (5 PDB entries)
  8. 2561587Domain d1qqja2: 1qqj A:119-416 [59035]
    Other proteins in same PDB: d1qqja1, d1qqjb1
    complexed with act, ca, cac

Details for d1qqja2

PDB Entry: 1qqj (more details), 1.55 Å

PDB Description: crystal structure of mouse fumarylacetoacetate hydrolase refined at 1.55 angstrom resolution
PDB Compounds: (A:) fumarylacetoacetate hydrolase

SCOPe Domain Sequences for d1qqja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qqja2 d.177.1.1 (A:119-416) Fumarylacetoacetate hydrolase, FAH, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
atigdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmg
qmrpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsard
iqqweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdin
lsvslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpes
fgsmlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpal

SCOPe Domain Coordinates for d1qqja2:

Click to download the PDB-style file with coordinates for d1qqja2.
(The format of our PDB-style files is described here.)

Timeline for d1qqja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qqja1