Lineage for d1qcrb2 (1qcr B:236-439)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 199430Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
  4. 199431Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
  5. 199432Family d.185.1.1: MPP-like [63412] (4 proteins)
  6. 199457Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
  7. 199472Species Cow (Bos taurus) [TaxId:9913] [56000] (3 PDB entries)
  8. 199476Domain d1qcrb2: 1qcr B:236-439 [59028]
    Other proteins in same PDB: d1qcra1, d1qcra2, d1qcrc1, d1qcrd2, d1qcrd3, d1qcre1, d1qcre2, d1qcrf1, d1qcrg1, d1qcrh1, d1qcrj1, d1qcrk1

Details for d1qcrb2

PDB Entry: 1qcr (more details), 2.7 Å

PDB Description: crystal structure of bovine mitochondrial cytochrome bc1 complex, alpha carbon atoms only

SCOP Domain Sequences for d1qcrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcrb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Cow (Bos taurus)}
kakyhggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatssl
yqavakgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnp
dvqaaknklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaak
kfvsgrksmaasgnlghtpfidel

SCOP Domain Coordinates for d1qcrb2:

Click to download the PDB-style file with coordinates for d1qcrb2.
(The format of our PDB-style files is described here.)

Timeline for d1qcrb2: