Lineage for d1qcrb1 (1qcr B:17-235)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 337578Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 337579Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 337580Family d.185.1.1: MPP-like [63412] (4 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 337613Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
  7. 337632Species Cow (Bos taurus) [TaxId:9913] [56000] (5 PDB entries)
  8. 337639Domain d1qcrb1: 1qcr B:17-235 [59027]
    Other proteins in same PDB: d1qcra1, d1qcra2, d1qcrc2, d1qcrc3, d1qcrd2, d1qcrd3, d1qcre1, d1qcre2, d1qcrf_, d1qcrg_, d1qcrh_, d1qcrj_, d1qcrk_

Details for d1qcrb1

PDB Entry: 1qcr (more details), 2.7 Å

PDB Description: crystal structure of bovine mitochondrial cytochrome bc1 complex, alpha carbon atoms only

SCOP Domain Sequences for d1qcrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcrb1 d.185.1.1 (B:17-235) Cytochrome bc1 core subunit 2 {Cow (Bos taurus)}
vpphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlasslt
tkgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwe
vaalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvq
nhftsarmaliglgvshpvlkqvaeqflnirgglglsga

SCOP Domain Coordinates for d1qcrb1:

Click to download the PDB-style file with coordinates for d1qcrb1.
(The format of our PDB-style files is described here.)

Timeline for d1qcrb1: