SCOP 1.61: Domain d1qcrb1: 1qcr B:17-235

Lineage for d1qcrb1 (1qcr B:17-235)

Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)
Family d.185.1.1: MPP-like [63412] (4 proteins)
Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
Species Cow (Bos taurus) [TaxId:9913] [56000] (3 PDB entries)
Domain d1qcrb1: 1qcr B:17-235 [59027]
Other proteins in same PDB: d1qcra1, d1qcra2, d1qcrc1, d1qcrd2, d1qcrd3, d1qcre1, d1qcre2, d1qcrf1, d1qcrg1, d1qcrh1, d1qcrj1, d1qcrk1

Details for d1qcrb1

PDB Entry: 1qcr (more details), 2.7 Å

PDB Description: crystal structure of bovine mitochondrial cytochrome bc1 complex, alpha carbon atoms only

SCOP Domain Sequences for d1qcrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcrb1 d.185.1.1 (B:17-235) Cytochrome bc1 core subunit 2 {Cow (Bos taurus)}
vpphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlasslt
tkgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwe
vaalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvq
nhftsarmaliglgvshpvlkqvaeqflnirgglglsga

SCOP Domain Coordinates for d1qcrb1:

Click to download the PDB-style file with coordinates for d1qcrb1.
(The format of our PDB-style files is described here.)

Timeline for d1qcrb1: