Lineage for d1qcra2 (1qcr A:234-446)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1444881Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 1444882Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 1444883Family d.185.1.1: MPP-like [63412] (6 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 1444884Protein Cytochrome bc1 core subunit 1 [63408] (3 species)
  7. 1444913Species Cow (Bos taurus) [TaxId:9913] [55997] (18 PDB entries)
    Uniprot P31800
  8. 1444957Domain d1qcra2: 1qcr A:234-446 [59026]
    Other proteins in same PDB: d1qcrb1, d1qcrb2, d1qcrc2, d1qcrc3, d1qcrd2, d1qcrd3, d1qcre1, d1qcre2, d1qcrf_, d1qcrg_, d1qcrh_, d1qcrj_, d1qcrk_
    complexed with hem

Details for d1qcra2

PDB Entry: 1qcr (more details), 2.7 Å

PDB Description: crystal structure of bovine mitochondrial cytochrome bc1 complex, alpha carbon atoms only
PDB Compounds: (A:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d1qcra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcra2 d.185.1.1 (A:234-446) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]}
crftgsqichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssp
lasiaatnklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatese
vlrgknllrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcsk
yfydqcpavagfgpveqlpdynrirsgmfwlrf

SCOPe Domain Coordinates for d1qcra2:

Click to download the PDB-style file with coordinates for d1qcra2.
(The format of our PDB-style files is described here.)

Timeline for d1qcra2: