SCOP 1.59: Domain d1qcob2: 1qco B:619-917

Lineage for d1qcob2 (1qco B:619-917)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.177: FAH [56528] (1 superfamily)

4. Superfamily d.177.1: FAH [56529] (1 family)

5. Family d.177.1.1: FAH [56530] (2 proteins)

6. Protein Fumarylacetoacetate hydrolase, FAH, C-terminal domain [63432] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [56532] (4 PDB entries)

8. Domain d1qcob2: 1qco B:619-917 [59024]
   Other proteins in same PDB: d1qcoa1, d1qcob1

Details for d1qcob2

PDB Entry: 1qco, 1.9 Å

PDB Description: crystal structure of fumarylacetoacetate hydrolase complexed with fumarate and acetoacetate

SCOP Domain Sequences for d1qcob2:

Sequence; same for both SEQRES and ATOM records:

>d1qcob2 d.177.1.1 (B:619-917) Fumarylacetoacetate hydrolase, FAH, C-terminal domain {Mouse (Mus musculus)}
atigdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmg
qmrpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsard
iqqweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdin
lsvslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpes
fgsmlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpals

Timeline for d1qcob2:

• d1qcob2 first appeared in SCOP 1.57
  
• d1qcob2 appears in SCOP 1.61
  
• d1qcob2 appears in the current release, SCOPe 2.08