Lineage for d1qcob1 (1qco B:499-618)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1784716Superfamily b.34.8: Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63433] (2 families) (S)
    automatically mapped to Pfam PF09298
  5. 1784717Family b.34.8.1: Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63434] (1 protein)
    contains 5 short helices in the loop between the third and fourth strands
  6. 1784718Protein Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63435] (1 species)
  7. 1784719Species Mouse (Mus musculus) [TaxId:10090] [63436] (5 PDB entries)
  8. 1784727Domain d1qcob1: 1qco B:499-618 [59023]
    Other proteins in same PDB: d1qcoa2, d1qcob2
    complexed with aae, ca, fum, ni

Details for d1qcob1

PDB Entry: 1qco (more details), 1.9 Å

PDB Description: crystal structure of fumarylacetoacetate hydrolase complexed with fumarate and acetoacetate
PDB Compounds: (B:) fumarylacetoacetate hydrolase

SCOPe Domain Sequences for d1qcob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcob1 b.34.8.1 (B:499-618) Fumarylacetoacetate hydrolase, FAH, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
gsmsfipvaedsdfpiqnlpygvfstqsnpkprigvaigdqildlsvikhlftgpalskh
qhvfdettlnnfmglgqaawkearaslqnllsasqarlrddkelrqraftsqasatmhlp

SCOPe Domain Coordinates for d1qcob1:

Click to download the PDB-style file with coordinates for d1qcob1.
(The format of our PDB-style files is described here.)

Timeline for d1qcob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qcob2