Lineage for d1qcob1 (1qco B:499-618)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796943Superfamily b.34.8: Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63433] (1 family) (S)
  5. 796944Family b.34.8.1: Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63434] (1 protein)
    contains 5 short helices in the loop between the third and fourth strands
  6. 796945Protein Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63435] (1 species)
  7. 796946Species Mouse (Mus musculus) [TaxId:10090] [63436] (5 PDB entries)
  8. 796954Domain d1qcob1: 1qco B:499-618 [59023]
    Other proteins in same PDB: d1qcoa2, d1qcob2
    complexed with aae, ca, fum, ni

Details for d1qcob1

PDB Entry: 1qco (more details), 1.9 Å

PDB Description: crystal structure of fumarylacetoacetate hydrolase complexed with fumarate and acetoacetate
PDB Compounds: (B:) fumarylacetoacetate hydrolase

SCOP Domain Sequences for d1qcob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcob1 b.34.8.1 (B:499-618) Fumarylacetoacetate hydrolase, FAH, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
gsmsfipvaedsdfpiqnlpygvfstqsnpkprigvaigdqildlsvikhlftgpalskh
qhvfdettlnnfmglgqaawkearaslqnllsasqarlrddkelrqraftsqasatmhlp

SCOP Domain Coordinates for d1qcob1:

Click to download the PDB-style file with coordinates for d1qcob1.
(The format of our PDB-style files is described here.)

Timeline for d1qcob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qcob2