![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.8: Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63433] (2 families) ![]() automatically mapped to Pfam PF09298 |
![]() | Family b.34.8.1: Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63434] (1 protein) contains 5 short helices in the loop between the third and fourth strands |
![]() | Protein Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63435] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [63436] (5 PDB entries) |
![]() | Domain d1qcob1: 1qco B:501-618 [59023] Other proteins in same PDB: d1qcoa2, d1qcob2, d1qcob3 complexed with aae, ca, fum, ni |
PDB Entry: 1qco (more details), 1.9 Å
SCOPe Domain Sequences for d1qcob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qcob1 b.34.8.1 (B:501-618) Fumarylacetoacetate hydrolase, FAH, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} msfipvaedsdfpiqnlpygvfstqsnpkprigvaigdqildlsvikhlftgpalskhqh vfdettlnnfmglgqaawkearaslqnllsasqarlrddkelrqraftsqasatmhlp
Timeline for d1qcob1: