Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.177: FAH [56528] (1 superfamily) unusual fold; contains 3 layers of beta-sheet structure |
Superfamily d.177.1: FAH [56529] (1 family) |
Family d.177.1.1: FAH [56530] (6 proteins) |
Protein Fumarylacetoacetate hydrolase, FAH, C-terminal domain [63432] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [56532] (5 PDB entries) |
Domain d1qcoa2: 1qco A:119-417 [59022] Other proteins in same PDB: d1qcoa1, d1qcob1 |
PDB Entry: 1qco (more details), 1.9 Å
SCOP Domain Sequences for d1qcoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qcoa2 d.177.1.1 (A:119-417) Fumarylacetoacetate hydrolase, FAH, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} atigdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmg qmrpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsard iqqweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdin lsvslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpes fgsmlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpals
Timeline for d1qcoa2: