SCOP 1.75: Domain d1qcnb2: 1qcn B:619-918

Lineage for d1qcnb2 (1qcn B:619-918)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.177: FAH [56528] (1 superfamily)
   unusual fold; contains 3 layers of beta-sheet structure

4. Superfamily d.177.1: FAH [56529] (1 family)

5. Family d.177.1.1: FAH [56530] (6 proteins)

6. Protein Fumarylacetoacetate hydrolase, FAH, C-terminal domain [63432] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [56532] (5 PDB entries)

8. Domain d1qcnb2: 1qcn B:619-918 [59020]
   Other proteins in same PDB: d1qcna1, d1qcnb1
   complexed with act, ca, ni

Details for d1qcnb2

PDB Entry: 1qcn, 1.9 Å

PDB Description: crystal structure of fumarylacetoacetate hydrolase

PDB Compounds: (B:) fumarylacetoacetate hydrolase

SCOP Domain Sequences for d1qcnb2:

Sequence; same for both SEQRES and ATOM records:

>d1qcnb2 d.177.1.1 (B:619-918) Fumarylacetoacetate hydrolase, FAH, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
atigdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmg
qmrpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsard
iqqweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdin
lsvslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpes
fgsmlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpalsp

Timeline for d1qcnb2:

• d1qcnb2 first appeared in SCOP 1.57
  
• d1qcnb2 appears in SCOP 1.73
  
• d1qcnb2 appears in SCOPe 2.01
  
• d1qcnb2 appears in the current release, SCOPe 2.08