Lineage for d1qcna2 (1qcn A:119-417)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879085Fold d.177: FAH [56528] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure
  4. 879086Superfamily d.177.1: FAH [56529] (1 family) (S)
  5. 879087Family d.177.1.1: FAH [56530] (6 proteins)
  6. 879117Protein Fumarylacetoacetate hydrolase, FAH, C-terminal domain [63432] (1 species)
  7. 879118Species Mouse (Mus musculus) [TaxId:10090] [56532] (5 PDB entries)
  8. 879127Domain d1qcna2: 1qcn A:119-417 [59018]
    Other proteins in same PDB: d1qcna1, d1qcnb1

Details for d1qcna2

PDB Entry: 1qcn (more details), 1.9 Å

PDB Description: crystal structure of fumarylacetoacetate hydrolase
PDB Compounds: (A:) fumarylacetoacetate hydrolase

SCOP Domain Sequences for d1qcna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcna2 d.177.1.1 (A:119-417) Fumarylacetoacetate hydrolase, FAH, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
atigdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmg
qmrpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsard
iqqweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdin
lsvslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpes
fgsmlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpals

SCOP Domain Coordinates for d1qcna2:

Click to download the PDB-style file with coordinates for d1qcna2.
(The format of our PDB-style files is described here.)

Timeline for d1qcna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qcna1