Lineage for d1opma2 (1opm A:199-354)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.13: PNGase F-like [49741] (2 superfamilies) 
Superfamily b.13.1: PHM/PNGase F [49742] (2 families) 
Family b.13.1.2: Peptidylglycine alpha-hydroxylating monooxygenase, PHM [49746] (1 protein) Protein Peptidylglycine alpha-hydroxylating monooxygenase, PHM [63402] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [49748] (3 PDB entries) 
Domain d1opma2: 1opm A:199-354 [59014]
Details for d1opma2
PDB Entry: 1opm (more details), 2.1 Å
PDB Description: oxidized (cu2+) peptidylglycine alpha-hydroxylating monooxygenase (phm) with bound substrate
SCOP Domain Sequences for d1opma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1opma2 b.13.1.2 (A:199-354) Peptidylglycine alpha-hydroxylating monooxygenase, PHM {Rat (Rattus norvegicus)}
pliagmylmmsvdtvippgekvvnadiscqykmypmhvfayrvhthhlgkvvsgyrvrng
qwtligrqnpqlpqafypvehpvdvtfgdilaarcvftgegrteathiggtssdemcnly
imyymeakyalsfmtctknvapdmfrtipaeanipi
SCOP Domain Coordinates for d1opma2:
Click to download the PDB-style file with coordinates for d1opma2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1opma2:
- d1opma2 is new in SCOP 1.57
- d1opma2 appears in SCOP 1.59
- d1opma2 appears in the current release, SCOPe 2.08
View in 3D
