Lineage for d1npca_ (1npc A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2963595Family d.92.1.2: Thermolysin-like [55490] (5 proteins)
    includes alpha-helical C-terminal domain characteristic for the family
  6. 2963607Protein Neutral protease [63415] (1 species)
  7. 2963608Species Bacillus cereus, strain dsm 3101 [TaxId:1396] [55496] (2 PDB entries)
  8. 2963609Domain d1npca_: 1npc A: [59012]
    complexed with ca, zn

Details for d1npca_

PDB Entry: 1npc (more details), 2 Å

PDB Description: the structure of neutral protease from bacillus cereus at 0.2-nm resolution
PDB Compounds: (A:) neutral protease

SCOPe Domain Sequences for d1npca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1npca_ d.92.1.2 (A:) Neutral protease {Bacillus cereus, strain dsm 3101 [TaxId: 1396]}
vtgtnkvgtgkgvlgdtkslnttlsgssyylqdntrgatiftydaknrstlpgtlwadad
nvfnaaydaaavdahyyagktydyykatfnrnsindagaplkstvhygsnynnafwngsq
mvygdgdgvtftslsggidvighelthavtenssnliyqnesgalneaisdifgtlvefy
dnrnpdweigediytpgkagdalrsmsdptkygdpdhyskrytgssdnggvhtnsgiink
qayllanggthygvtvtgigkdklgaiyyrantqyftqsttfsqaragavqaaadlygan
saevaavkqsfsavgvn

SCOPe Domain Coordinates for d1npca_:

Click to download the PDB-style file with coordinates for d1npca_.
(The format of our PDB-style files is described here.)

Timeline for d1npca_: