![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.2: Thermolysin-like [55490] (5 proteins) includes alpha-helical C-terminal domain characteristic for the family |
![]() | Protein Neutral protease [63415] (1 species) |
![]() | Species Bacillus cereus, strain dsm 3101 [TaxId:1396] [55496] (2 PDB entries) |
![]() | Domain d1npca_: 1npc A: [59012] complexed with ca, zn |
PDB Entry: 1npc (more details), 2 Å
SCOPe Domain Sequences for d1npca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1npca_ d.92.1.2 (A:) Neutral protease {Bacillus cereus, strain dsm 3101 [TaxId: 1396]} vtgtnkvgtgkgvlgdtkslnttlsgssyylqdntrgatiftydaknrstlpgtlwadad nvfnaaydaaavdahyyagktydyykatfnrnsindagaplkstvhygsnynnafwngsq mvygdgdgvtftslsggidvighelthavtenssnliyqnesgalneaisdifgtlvefy dnrnpdweigediytpgkagdalrsmsdptkygdpdhyskrytgssdnggvhtnsgiink qayllanggthygvtvtgigkdklgaiyyrantqyftqsttfsqaragavqaaadlygan saevaavkqsfsavgvn
Timeline for d1npca_: