Lineage for d1hyob2 (1hyo B:619-917)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 139850Fold d.177: FAH [56528] (1 superfamily)
  4. 139851Superfamily d.177.1: FAH [56529] (1 family) (S)
  5. 139852Family d.177.1.1: FAH [56530] (2 proteins)
  6. 139863Protein Fumarylacetoacetate hydrolase, FAH, C-terminal domain [63432] (1 species)
  7. 139864Species Mouse (Mus musculus) [TaxId:10090] [56532] (4 PDB entries)
  8. 139866Domain d1hyob2: 1hyo B:619-917 [59004]
    Other proteins in same PDB: d1hyoa1, d1hyob1

Details for d1hyob2

PDB Entry: 1hyo (more details), 1.3 Å

PDB Description: crystal structure of fumarylacetoacetate hydrolase complexed with 4-(hydroxymethylphosphinoyl)-3-oxo-butanoic acid

SCOP Domain Sequences for d1hyob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hyob2 d.177.1.1 (B:619-917) Fumarylacetoacetate hydrolase, FAH, C-terminal domain {Mouse (Mus musculus)}
atigdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmg
qmrpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsard
iqqweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdin
lsvslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpes
fgsmlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpals

SCOP Domain Coordinates for d1hyob2:

Click to download the PDB-style file with coordinates for d1hyob2.
(The format of our PDB-style files is described here.)

Timeline for d1hyob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hyob1