SCOP 1.75: Domain d1hyoa1: 1hyo A:1-118

Lineage for d1hyoa1 (1hyo A:1-118)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.8: Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63433] (1 family)

5. Family b.34.8.1: Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63434] (1 protein)
   contains 5 short helices in the loop between the third and fourth strands

6. Protein Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63435] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [63436] (5 PDB entries)

8. Domain d1hyoa1: 1hyo A:1-118 [59001]
   Other proteins in same PDB: d1hyoa2, d1hyob2

Details for d1hyoa1

PDB Entry: 1hyo, 1.3 Å

PDB Description: crystal structure of fumarylacetoacetate hydrolase complexed with 4-(hydroxymethylphosphinoyl)-3-oxo-butanoic acid

PDB Compounds: (A:) fumarylacetoacetate hydrolase

SCOP Domain Sequences for d1hyoa1:

Sequence; same for both SEQRES and ATOM records:

>d1hyoa1 b.34.8.1 (A:1-118) Fumarylacetoacetate hydrolase, FAH, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
msfipvaedsdfpiqnlpygvfstqsnpkprigvaigdqildlsvikhlftgpalskhqh
vfdettlnnfmglgqaawkearaslqnllsasqarlrddkelrqraftsqasatmhlp

Timeline for d1hyoa1:

• d1hyoa1 first appeared in SCOP 1.57
  
• d1hyoa1 appears in SCOP 1.73
  
• d1hyoa1 appears in SCOPe 2.01
  
• d1hyoa1 appears in the current release, SCOPe 2.08