SCOP 1.57: Domain d1g2923: 1g29 2:241-301

Lineage for d1g2923 (1g29 2:241-301)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.40: OB-fold [50198] (7 superfamilies)

4. Superfamily b.40.6: MOP-like [50331] (3 families)

5. Family b.40.6.3: Maltose transport protein MalK, C-terminal domain [50338] (1 protein)

6. Protein Maltose transport protein MalK, C-terminal domain [63406] (1 species)

7. Species Archaeon Thermococcus litoralis [TaxId:2265] [50340] (1 PDB entry)

8. Domain d1g2923: 1g29 2:241-301 [58983]
   Other proteins in same PDB: d1g2912, d1g2922

Details for d1g2923

PDB Entry: 1g29, 1.9 Å

PDB Description: malk

SCOP Domain Sequences for d1g2923:

Sequence; same for both SEQRES and ATOM records:

>d1g2923 b.40.6.3 (2:241-301) Maltose transport protein MalK, C-terminal domain {Archaeon Thermococcus litoralis}
gsppmnfldaivtedgfvdfgefrlkllpdqfevlgelgyvgrevifgirpedlydamfa
q

Timeline for d1g2923:

• d1g2923 is new in SCOP 1.57
  
• d1g2923 appears in SCOP 1.59
  
• d1g2923 appears in the current release, SCOPe 2.08