Lineage for d1bgyn2 (1bgy N:236-439)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 139995Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
  4. 139996Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
  5. 139997Family d.185.1.1: MPP-like [63412] (4 proteins)
  6. 140018Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
  7. 140029Species Cow (Bos taurus) [TaxId:9913] [56000] (3 PDB entries)
  8. 140037Domain d1bgyn2: 1bgy N:236-439 [58961]
    Other proteins in same PDB: d1bgya1, d1bgya2, d1bgyc1, d1bgyd2, d1bgyd3, d1bgye1, d1bgyf1, d1bgyg1, d1bgyh1, d1bgyj1, d1bgyk1, d1bgym1, d1bgym2, d1bgyo1, d1bgyp2, d1bgyp3, d1bgyq1, d1bgyq2, d1bgyr1, d1bgys1, d1bgyt1, d1bgyv1, d1bgyw1

Details for d1bgyn2

PDB Entry: 1bgy (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1bgyn2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgyn2 d.185.1.1 (N:236-439) Cytochrome bc1 core subunit 2 {Cow (Bos taurus)}
kakyhggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatssl
yqavakgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnp
dvqaaknklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaak
kfvsgrksmaasgnlghtpfidel

SCOP Domain Coordinates for d1bgyn2:

Click to download the PDB-style file with coordinates for d1bgyn2.
(The format of our PDB-style files is described here.)

Timeline for d1bgyn2: