Lineage for d1bgym1 (1bgy M:1-233)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 199430Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
  4. 199431Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
  5. 199432Family d.185.1.1: MPP-like [63412] (4 proteins)
  6. 199433Protein Cytochrome bc1 core subunit 1 [63408] (3 species)
  7. 199448Species Cow (Bos taurus) [TaxId:9913] [55997] (3 PDB entries)
  8. 199455Domain d1bgym1: 1bgy M:1-233 [58958]
    Other proteins in same PDB: d1bgyb1, d1bgyb2, d1bgyc1, d1bgyd2, d1bgyd3, d1bgye1, d1bgyf1, d1bgyg1, d1bgyh1, d1bgyj1, d1bgyk1, d1bgyn1, d1bgyn2, d1bgyo1, d1bgyp2, d1bgyp3, d1bgyq1, d1bgyq2, d1bgyr1, d1bgys1, d1bgyt1, d1bgyv1, d1bgyw1

Details for d1bgym1

PDB Entry: 1bgy (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1bgym1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgym1 d.185.1.1 (M:1-233) Cytochrome bc1 core subunit 1 {Cow (Bos taurus)}
tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlsp

SCOP Domain Coordinates for d1bgym1:

Click to download the PDB-style file with coordinates for d1bgym1.
(The format of our PDB-style files is described here.)

Timeline for d1bgym1: