Lineage for d1bgyb1 (1bgy B:21-235)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 337578Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 337579Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 337580Family d.185.1.1: MPP-like [63412] (4 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 337613Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
  7. 337632Species Cow (Bos taurus) [TaxId:9913] [56000] (5 PDB entries)
  8. 337641Domain d1bgyb1: 1bgy B:21-235 [58956]
    Other proteins in same PDB: d1bgya1, d1bgya2, d1bgyc2, d1bgyc3, d1bgyd2, d1bgyd3, d1bgye_, d1bgyf_, d1bgyg_, d1bgyh_, d1bgyj_, d1bgyk_, d1bgym1, d1bgym2, d1bgyo2, d1bgyo3, d1bgyp2, d1bgyp3, d1bgyq1, d1bgyq2, d1bgyr_, d1bgys_, d1bgyt_, d1bgyv_, d1bgyw_

Details for d1bgyb1

PDB Entry: 1bgy (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1bgyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgyb1 d.185.1.1 (B:21-235) Cytochrome bc1 core subunit 2 {Cow (Bos taurus)}
pqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlasslttkga
ssfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwevaal
qpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvqnhft
sarmaliglgvshpvlkqvaeqflnirgglglsga

SCOP Domain Coordinates for d1bgyb1:

Click to download the PDB-style file with coordinates for d1bgyb1.
(The format of our PDB-style files is described here.)

Timeline for d1bgyb1: