Lineage for d1bgyb1 (1bgy B:21-235)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 86102Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
  4. 86103Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
  5. 86104Family d.185.1.1: MPP-like [63412] (4 proteins)
  6. 86125Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
  7. 86136Species Cow (Bos taurus) [TaxId:9913] [56000] (3 PDB entries)
  8. 86141Domain d1bgyb1: 1bgy B:21-235 [58956]
    Other proteins in same PDB: d1bgya1, d1bgya2, d1bgyc1, d1bgyd2, d1bgyd3, d1bgye1, d1bgyf1, d1bgyg1, d1bgyh1, d1bgyj1, d1bgyk1, d1bgym1, d1bgym2, d1bgyo1, d1bgyp2, d1bgyp3, d1bgyq1, d1bgyq2, d1bgyr1, d1bgys1, d1bgyt1, d1bgyv1, d1bgyw1

Details for d1bgyb1

PDB Entry: 1bgy (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1bgyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgyb1 d.185.1.1 (B:21-235) Cytochrome bc1 core subunit 2 {Cow (Bos taurus)}
pqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlasslttkga
ssfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwevaal
qpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvqnhft
sarmaliglgvshpvlkqvaeqflnirgglglsga

SCOP Domain Coordinates for d1bgyb1:

Click to download the PDB-style file with coordinates for d1bgyb1.
(The format of our PDB-style files is described here.)

Timeline for d1bgyb1: