Lineage for d1be3b2 (1be3 B:236-439)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 739189Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 739190Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 739191Family d.185.1.1: MPP-like [63412] (6 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 739258Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
  7. 739293Species Cow (Bos taurus) [TaxId:9913] [56000] (12 PDB entries)
  8. 739317Domain d1be3b2: 1be3 B:236-439 [58953]
    Other proteins in same PDB: d1be3a1, d1be3a2, d1be3c2, d1be3c3, d1be3d2, d1be3d3, d1be3e1, d1be3e2, d1be3f_, d1be3g_, d1be3h_, d1be3j_, d1be3k_
    complexed with fes, hec, hem

Details for d1be3b2

PDB Entry: 1be3 (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine
PDB Compounds: (B:) cytochrome bc1 complex

SCOP Domain Sequences for d1be3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1be3b2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]}
kakyhggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatssl
yqavakgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnp
dvqaaknklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaak
kfvsgrksmaasgnlghtpfidel

SCOP Domain Coordinates for d1be3b2:

Click to download the PDB-style file with coordinates for d1be3b2.
(The format of our PDB-style files is described here.)

Timeline for d1be3b2: