![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
![]() | Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
![]() | Family d.185.1.1: MPP-like [63412] (7 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
![]() | Protein Cytochrome bc1 core subunit 2 [63409] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [56000] (17 PDB entries) Uniprot P23004 |
![]() | Domain d1be3b1: 1be3 B:21-235 [58952] Other proteins in same PDB: d1be3a1, d1be3a2, d1be3c2, d1be3c3, d1be3d2, d1be3d3, d1be3e1, d1be3e2, d1be3f_, d1be3g_, d1be3h_, d1be3i_, d1be3j_, d1be3k_ complexed with fes, hec, hem |
PDB Entry: 1be3 (more details), 3 Å
SCOPe Domain Sequences for d1be3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1be3b1 d.185.1.1 (B:21-235) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]} pqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlasslttkga ssfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwevaal qpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvqnhft sarmaliglgvshpvlkqvaeqflnirgglglsga
Timeline for d1be3b1: