Lineage for d1be3b1 (1be3 B:21-235)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 265229Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 265230Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 265231Family d.185.1.1: MPP-like [63412] (4 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 265258Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
  7. 265275Species Cow (Bos taurus) [TaxId:9913] [56000] (3 PDB entries)
  8. 265276Domain d1be3b1: 1be3 B:21-235 [58952]
    Other proteins in same PDB: d1be3a1, d1be3a2, d1be3c2, d1be3c3, d1be3d2, d1be3d3, d1be3e1, d1be3e2, d1be3f_, d1be3g_, d1be3h_, d1be3j_, d1be3k_

Details for d1be3b1

PDB Entry: 1be3 (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1be3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1be3b1 d.185.1.1 (B:21-235) Cytochrome bc1 core subunit 2 {Cow (Bos taurus)}
pqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlasslttkga
ssfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwevaal
qpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvqnhft
sarmaliglgvshpvlkqvaeqflnirgglglsga

SCOP Domain Coordinates for d1be3b1:

Click to download the PDB-style file with coordinates for d1be3b1.
(The format of our PDB-style files is described here.)

Timeline for d1be3b1: