Lineage for d1be3b1 (1be3 B:21-235)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 199430Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
  4. 199431Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
  5. 199432Family d.185.1.1: MPP-like [63412] (4 proteins)
  6. 199457Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
  7. 199472Species Cow (Bos taurus) [TaxId:9913] [56000] (3 PDB entries)
  8. 199473Domain d1be3b1: 1be3 B:21-235 [58952]
    Other proteins in same PDB: d1be3a1, d1be3a2, d1be3c1, d1be3d2, d1be3d3, d1be3e1, d1be3e2, d1be3f1, d1be3g1, d1be3h1, d1be3j1, d1be3k1

Details for d1be3b1

PDB Entry: 1be3 (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1be3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1be3b1 d.185.1.1 (B:21-235) Cytochrome bc1 core subunit 2 {Cow (Bos taurus)}
pqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlasslttkga
ssfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwevaal
qpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvqnhft
sarmaliglgvshpvlkqvaeqflnirgglglsga

SCOP Domain Coordinates for d1be3b1:

Click to download the PDB-style file with coordinates for d1be3b1.
(The format of our PDB-style files is described here.)

Timeline for d1be3b1: