SCOP 1.61: Domain d1be3a1: 1be3 A:1-233

Lineage for d1be3a1 (1be3 A:1-233)

Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)
Family d.185.1.1: MPP-like [63412] (4 proteins)
Protein Cytochrome bc1 core subunit 1 [63408] (3 species)
Species Cow (Bos taurus) [TaxId:9913] [55997] (3 PDB entries)
Domain d1be3a1: 1be3 A:1-233 [58950]
Other proteins in same PDB: d1be3b1, d1be3b2, d1be3c1, d1be3d2, d1be3d3, d1be3e1, d1be3e2, d1be3f1, d1be3g1, d1be3h1, d1be3j1, d1be3k1

Details for d1be3a1

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1be3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1be3a1 d.185.1.1 (A:1-233) Cytochrome bc1 core subunit 1 {Cow (Bos taurus)}
tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlsp

SCOP Domain Coordinates for d1be3a1:

Click to download the PDB-style file with coordinates for d1be3a1.
(The format of our PDB-style files is described here.)

Timeline for d1be3a1: