Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) |
Family d.185.1.1: MPP-like [63412] (4 proteins) |
Protein Cytochrome bc1 core subunit 2 [63409] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [56001] (3 PDB entries) |
Domain d1bccb1: 1bcc B:18-235 [58948] Other proteins in same PDB: d1bcca1, d1bcca2, d1bccc1, d1bccd2, d1bccd3, d1bcce1, d1bcce2, d1bccf1, d1bccg1, d1bcch1, d1bccj1 |
PDB Entry: 1bcc (more details), 3.16 Å
SCOP Domain Sequences for d1bccb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bccb1 d.185.1.1 (B:18-235) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus)} pphpqdleitklpnglviaslenyspgstigvfikagsryenssnlgtshllrlassltt kgassfkitrgieavggklsvestrenmaytveclrddveilmefllnvttapefrpwev adlqpqlkidkavafqnpqthvienlhaaayrnaladslycpdyrigkvtsvelhdfvqn hftsarmalvglgvshpvlknvaeqllnirgglglsga
Timeline for d1bccb1: