Lineage for d1bccb1 (1bcc B:18-235)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 86102Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
  4. 86103Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
  5. 86104Family d.185.1.1: MPP-like [63412] (4 proteins)
  6. 86125Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
  7. 86129Species Chicken (Gallus gallus) [TaxId:9031] [56001] (3 PDB entries)
  8. 86130Domain d1bccb1: 1bcc B:18-235 [58948]
    Other proteins in same PDB: d1bcca1, d1bcca2, d1bccc1, d1bccd2, d1bccd3, d1bcce1, d1bcce2, d1bccf1, d1bccg1, d1bcch1, d1bccj1

Details for d1bccb1

PDB Entry: 1bcc (more details), 3.16 Å

PDB Description: cytochrome bc1 complex from chicken
PDB Compounds: (B:)

SCOP Domain Sequences for d1bccb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bccb1 d.185.1.1 (B:18-235) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus)}
pphpqdleitklpnglviaslenyspgstigvfikagsryenssnlgtshllrlassltt
kgassfkitrgieavggklsvestrenmaytveclrddveilmefllnvttapefrpwev
adlqpqlkidkavafqnpqthvienlhaaayrnaladslycpdyrigkvtsvelhdfvqn
hftsarmalvglgvshpvlknvaeqllnirgglglsga

SCOP Domain Coordinates for d1bccb1:

Click to download the PDB-style file with coordinates for d1bccb1.
(The format of our PDB-style files is described here.)

Timeline for d1bccb1: