SCOP 1.61: Domain d1bcca1: 1bcc A:4-232

Lineage for d1bcca1 (1bcc A:4-232)

Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)
Family d.185.1.1: MPP-like [63412] (4 proteins)
Protein Cytochrome bc1 core subunit 1 [63408] (3 species)
Species Chicken (Gallus gallus) [TaxId:9031] [55998] (3 PDB entries)
Domain d1bcca1: 1bcc A:4-232 [58946]
Other proteins in same PDB: d1bccb1, d1bccb2, d1bccc1, d1bccd2, d1bccd3, d1bcce1, d1bcce2, d1bccf1, d1bccg1, d1bcch1, d1bccj1

Details for d1bcca1

PDB Entry: 1bcc (more details), 3.16 Å

PDB Description: cytochrome bc1 complex from chicken

SCOP Domain Sequences for d1bcca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bcca1 d.185.1.1 (A:4-232) Cytochrome bc1 core subunit 1 {Chicken (Gallus gallus)}
yaqalqsvpetqvsqldngvrvaseqssqptctvgvwidagsryeseknngagyflehla
fkgtknrpqnalekevesmgahlnayssrehtayyikalskdvpkavelladivqncsle
dsqiekerdvivrelqendtsmrevvfnylhatafqgtglaqsvegpsenirklsradlt
eylsthytaprmvlaaaggvehqqllelaqkhfggvpftydddavptls

SCOP Domain Coordinates for d1bcca1:

Click to download the PDB-style file with coordinates for d1bcca1.
(The format of our PDB-style files is described here.)

Timeline for d1bcca1: