Lineage for d1b9nb4 (1b9n B:200-262)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 59750Superfamily b.40.6: MOP-like [50331] (3 families) (S)
  5. 59766Family b.40.6.2: BiMOP, duplicated molybdate-binding domain [50335] (2 proteins)
  6. 59767Protein C-terminal domain of molybdate-dependent transcriptional regulator ModE [63405] (1 species)
  7. 59768Species Escherichia coli [TaxId:562] [50337] (4 PDB entries)
  8. 59784Domain d1b9nb4: 1b9n B:200-262 [58945]
    Other proteins in same PDB: d1b9na1, d1b9nb1

Details for d1b9nb4

PDB Entry: 1b9n (more details), 2.09 Å

PDB Description: regulator from escherichia coli

SCOP Domain Sequences for d1b9nb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b9nb4 b.40.6.2 (B:200-262) C-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli}
dnqlpgiishiergaeqcevlmalpdgqtlcatvpvneatslqqgqnvtayfnadsviia
tlc

SCOP Domain Coordinates for d1b9nb4:

Click to download the PDB-style file with coordinates for d1b9nb4.
(The format of our PDB-style files is described here.)

Timeline for d1b9nb4: