SCOP 1.71: Domain d1aiph2: 1aip H:54-196

Lineage for d1aiph2 (1aip H:54-196)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.43: EF-Ts domain-like [54712] (2 superfamilies)
   beta(2)-alpha(n)-beta; 2 layers a/b; antiparallel sheet: 123

4. Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family)
   comprises two structural repeats of this fold

5. Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (1 protein)

6. Protein Elongation factor Ts (EF-Ts), dimerisation domain [63422] (3 species)

7. Species Thermus thermophilus [TaxId:274] [54717] (2 PDB entries)

8. Domain d1aiph2: 1aip H:54-196 [58937]
   Other proteins in same PDB: d1aipa1, d1aipa2, d1aipa3, d1aipb1, d1aipb2, d1aipb3, d1aipc1, d1aipd1, d1aipe1, d1aipe2, d1aipe3, d1aipf1, d1aipf2, d1aipf3, d1aipg1, d1aiph1

Details for d1aiph2

PDB Entry: 1aip, 3 Å

PDB Description: ef-tu ef-ts complex from thermus thermophilus

SCOP Domain Sequences for d1aiph2:

Sequence; same for both SEQRES and ATOM records:

>d1aiph2 d.43.1.1 (H:54-196) Elongation factor Ts (EF-Ts), dimerisation domain {Thermus thermophilus}
earegiighyihhnqrvgvlvelncetdfvarnelfqnlakdlamhiammnpryvsaeei
paeelekerqiyiqaalnegkpqqiaekiaegrlkkyleevvlleqpfvkddkvkvkeli
qqaiakigenivvrrfcrfelga

Timeline for d1aiph2:

• d1aiph2 first appeared in SCOP 1.57
  
• d1aiph2 appears in SCOP 1.69
  
• d1aiph2 appears in SCOP 1.73
  
• d1aiph2 appears in the current release, SCOPe 2.08